Novus Biologicals
Manufacturer Code:NBP233397
Catalog # NBP233397
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hU2AF(65); hU2AF(65) hU2AF65 splicing factor U2AF 65 kD subunit splicing factor U2AF 65 kDa subunit U2 (RNU2) small nuclear RNA auxiliary factor 2 U2 auxiliary factor 65 kDa subunit U2 small nuclear ribonucleoprotein auxiliary factor (65kD) U2 small nuclear RNA auxiliary factor 2 U2AF65U2 snRNP auxiliary factor large subunit; hU2AF65; Splicing factor U2AF 65 kDa subunit; U2 (RNU2) small nuclear RNA auxiliary factor 2; U2 auxiliary factor 65 kDa subunit; U2 small nuclear ribonucleoprotein auxiliary factor (65kD); U2 snRNP auxiliary factor large subunit
Gene Aliases: U2AF2; U2AF65
UniProt ID: (Human) P26368
Entrez Gene ID: (Human) 11338
Molecular Function: RNA binding protein mRNA processing factor mRNA splicing factor nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.