Novus Biologicals
Manufacturer Code:NBP154820
Catalog # NBP154820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to Troponin T type 1 (slow skeletal) The peptide sequence was selected from the middle region of Troponin T type 1 (slow skeletal) Peptide sequence WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ANMtroponin T slow skeletal muscle FLJ98147 MGC104241 Slow skeletal muscle troponin T STNT TNTS TNTtroponin T1 skeletal slow troponin T type 1 (skeletal slow) troponin-T1 skeletal slow; Slow skeletal muscle troponin T; sTnT; TnTs; troponin T type 1 (skeletal, slow); Troponin T, slow skeletal muscle; troponin-T1, skeletal, slow
Gene Aliases: ANM; NEM5; STNT; TNNT1; TNT; TNTS
UniProt ID: (Human) P13805
Entrez Gene ID: (Human) 7138
Molecular Function:
actin binding motor protein
actin family cytoskeletal protein
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.