Novus Biologicals
Manufacturer Code:NBP15634020UL
Catalog # NBP15634020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human TNNT3 (NP_001036245). Peptide sequence QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta TnTF; Beta-TnTF; Beta-TnTF fast skeletal muscle TnTf troponin T type 3 (skeletal fast) troponin T3 skeletal fast troponin-T3 skeletal fast; Fast skeletal muscle troponin T; fTnT; TnTf; troponin T type 3 (skeletal, fast); Troponin T, fast skeletal muscle; troponin-T3, skeletal, fast
Gene Aliases: TNNT3; TNTF
UniProt ID: (Human) P45378
Entrez Gene ID: (Human) 7140
Molecular Function:
actin binding motor protein
actin family cytoskeletal protein
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.