Novus Biologicals
Manufacturer Code:NBP238265
Catalog # NBP238265
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp781I14186 EC 2.7.10 EC 2.7.10.1 MTChigh affinity nerve growth factor receptor Neurotrophic tyrosine kinase receptor type 1 neurotrophic tyrosine kinase receptor type 1 p140-TrkA TRK1-transforming tyrosine kinase protein Trk-A TRKAOncogene TRK TRKTRK1 tyrosine kinase receptor A; gp140trk; High affinity nerve growth factor receptor; Neurotrophic tyrosine kinase receptor type 1; neurotrophic tyrosine kinase, receptor, type 1; Oncogene TRK; p140-TrkA; Trk-A; TRK1-transforming tyrosine kinase protein; Tropomyosin-related kinase A; Tyrosine kinase receptor; Tyrosine kinase receptor A
Gene Aliases: MTC; NTRK1; p140-TrkA; TRK; Trk-A; TRK1; TRKA
UniProt ID: (Human) P04629
Entrez Gene ID: (Human) 4914
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.