Novus Biologicals
Manufacturer Code:NBP15288120UL
Catalog # NBP1528820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TPI1(triosephosphate isomerase 1) The peptide sequence was selected from the N terminal of TPI1. Peptide sequence MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 5.3.1.1 MGC88108 TIM TPI triosephosphate isomerase Triose-phosphate isomerase triosephosphate isomerase 1; epididymis secretory protein Li 49; Methylglyoxal synthase; TIM; Triose-phosphate isomerase; Triosephosphate isomerase
Gene Aliases: HEL-S-49; TIM; TPI; TPI1; TPID
UniProt ID: (Human) P60174
Entrez Gene ID: (Human) 7167
Molecular Function:
isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.