Novus Biologicals
Manufacturer Code:NBP174220
Catalog # NBP174220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the N terminal of Tcn2. Immunizing peptide sequence PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D22S676 D22S750 macrocytic anemia TC TC-2 TC2II TCII transcobalamin II macrocytic anemia transcobalamin IITC II transcobalamin-2 vitamin B12-binding protein 2; macrocytic anemia; TC II; TC-2; Transcobalamin II; transcobalamin II; macrocytic anemia; Transcobalamin-2; vitamin B12-binding protein 2
Gene Aliases: D22S676; D22S750; II; TC; TC II; TC-2; TC2; TCII; TCN2
UniProt ID: (Human) P20062
Entrez Gene ID: (Human) 6948
Molecular Function:
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.