Novus Biologicals
Manufacturer Code:NBP256137
Catalog # NBP256137
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DQ2Torsin family 1 member A Dystonia 1 protein dystonia 1 torsion (autosomal dominant torsin A) DYT1torsin-1A torsin family 1 member A (torsin A); Dystonia 1 protein; dystonia 1, torsion (autosomal dominant; torsin A); torsin A; torsin ATPase 1; Torsin ATPase-1A; Torsin family 1 member A; torsin family 1, member A (torsin A); Torsin-1A
Gene Aliases: DQ2; DYT1; TA; TOR1A; TORA
UniProt ID: (Human) O14656
Entrez Gene ID: (Human) 1861
Molecular Function: chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.