Novus Biologicals
Manufacturer Code:NBP158254
Catalog # NBP158254
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DNTT(deoxynucleotidyltransferase terminal) The peptide sequence was selected from the N terminal of DNTT. Peptide sequence FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: deoxynucleotidyltransferase terminal EC 2.7.7 EC 2.7.7.31 nucleosidetriphosphate:DNA deoxynucleotidylexotransferase TDTDNA nucleotidylexotransferase Terminal addition enzyme Terminal deoxynucleotidyltransferase terminal deoxyribonucleotidyltransferase Terminal transferase; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase; Terminal addition enzyme; Terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; Terminal transferase
Gene Aliases: DNTT; TDT
UniProt ID: (Human) P04053
Entrez Gene ID: (Human) 1791
Molecular Function:
DNA binding protein
DNA-directed DNA polymerase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.