Novus Biologicals
Manufacturer Code:NBP213497
Catalog # NBP213497
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRT ETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ENDOPDI ERP46 FLJ90810 HCC-2 member 15 MGC3178 PDIA15 thioredoxin domain containing 5 thioredoxin domain containing 5 (endoplasmic reticulum) thioredoxin domain-containing protein 5 thioredoxin related protein TLP46; endoplasmic reticulum protein ERp46; Endoplasmic reticulum resident protein 46; endothelial protein disulphide isomerase; ER protein 46; protein disulfide isomerase family A, member 15; thioredoxin domain containing 5 (endoplasmic reticulum); Thioredoxin domain-containing protein 5; thioredoxin related protein; Thioredoxin-like protein p46
Gene Aliases: ENDOPDI; ERP46; HCC-2; HCC2; PDIA15; STRF8; TLP46; TXNDC5; UNQ364; UNQ364/PRO700
UniProt ID: (Human) Q8NBS9
Entrez Gene ID: (Human) 81567
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.