Novus Biologicals
Manufacturer Code:NBP257861
Catalog # NBP257861
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7.19 EC 2.7.7.52 FLJ21850 FLJ22267 FLJ22347 MGC131987 MGC149809 nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase PAP-associated domain-containing 2 PAPD2 poly(A) polymerase associated domain containing 2 RBM21 RNA binding motif protein 21 RNA uridylyltransferase RNA-binding motif protein 21 RNA-binding protein 21 speckle targeted PIP5K1A-regulated poly(A) polymerase star-PAP STARPAP terminal uridylyl transferase 1 U6 snRNA-specific TUTase U6 snRNA-specific terminal uridylyltransferase 1 U6 TUTase U6-TUTase; nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpha regulated-poly(A) polymerase; nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase; PAP-associated domain-containing 2; poly(A) polymerase associated domain containing 2; RNA binding motif protein 21; RNA uridylyltransferase; RNA-binding motif protein 21; RNA-binding protein 21; Speckle targeted PIP5K1A-regulated poly(A) polymerase; Star-PAP; terminal uridylyl transferase 1 U6 snRNA-specific; TUTase 6; U6 snRNA-specific terminal uridylyltransferase 1; U6 TUTase; U6-TUTase; up-regulated in lung cancer 6
Gene Aliases: PAPD2; RBM21; STARPAP; TUT1; TUTase; URLC6
UniProt ID: (Human) Q9H6E5
Entrez Gene ID: (Human) 64852
Molecular Function:
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.