Novus Biologicals
Manufacturer Code:NBP190773
Catalog # NBP190773
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LAPDAFQIVLDSENEAKVSTGKNRGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA288G11.4 bA288G11.5 bB137A17.2 bB137A17.3 C10orf123 C10orf124 C10orf92 C10orf93 chromosome 10 open reading frame 93 RP11-288G11.4 RP13-137A17.3; Cilia- and flagella-associated protein 46; protein CFAP46; tetratricopeptide repeat domain 40; Tetratricopeptide repeat protein 40; TPR repeat-containing protein C10orf93
Gene Aliases: bA288G11.4; bA288G11.5; bB137A17.2; bB137A17.3; C10orf123; C10orf124; C10orf92; C10orf93; CFAP46; TTC40
UniProt ID: (Human) Q8IYW2
Entrez Gene ID: (Human) 54777
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.