Novus Biologicals
Manufacturer Code:NBP190416
Catalog # NBP190416
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATD4 JBTS11 KIAA1992 putative protein product of Nbla10696 tetratricopeptide repeat domain 21B tetratricopeptide repeat protein 21B THM1 TPR repeat protein 21B; Intraflagellar transport 139 homolog; putative protein product of Nbla10696; Tetratricopeptide repeat protein 21B; TPR repeat protein 21B
Gene Aliases: ATD4; IFT139; IFT139B; JBTS11; KIAA1992; Nbla10696; NPHP12; SRTD4; THM1; TTC21B
UniProt ID: (Human) Q7Z4L5
Entrez Gene ID: (Human) 79809
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.