Novus Biologicals
Manufacturer Code:NBP15913020UL
Catalog # NBP15913020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TSTA3(tissue specific transplantation antigen P35B) The peptide sequence was selected from the N terminal of TSTA3. Peptide sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-5 epimerase/4-reductase; EC 1.1.1.271 FX GDP-4-keto-6-deoxy-D-mannose epimerase-reductase GDP-4-keto-6-deoxy-D-mannose-35-epimerase-4-reductase GDP-L-fucose synthase P35B Protein FX Red cell NADP(H)-binding protein SDR4E13-5 epimerase/4-reductase short chain dehydrogenase/reductase family 4E member 1 Short-chain dehydrogenase/reductase family 4E member 1 tissue specific transplantation antigen 3 tissue specific transplantation antigen P35B Tissue-specific transplantation antigen-3; GDP-4-keto-6-deoxy-D-mannose epimerase-reductase; GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase; GDP-L-fucose synthase; Protein FX; Red cell NADP(H)-binding protein; short chain dehydrogenase/reductase family 4E, member 1; Short-chain dehydrogenase/reductase family 4E member 1; testis tissue sperm-binding protein Li 45a; tissue specific transplantation antigen 3
Gene Aliases: FX; GFUS; P35B; SDR4E1; TSTA3
UniProt ID: (Human) Q13630
Entrez Gene ID: (Human) 7264
Molecular Function:
dehydratase
epimerase/racemase
isomerase
lyase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.