Novus Biologicals
Manufacturer Code:NBP159088
Catalog # NBP159088
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PHLDA2(pleckstrin homology-like domain family A member 2) The peptide sequence was selected from the middle region of PHLDA2. Peptide sequence QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein; Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein BWR1Cp17-Beckwith-Wiedemann region 1 C HLDA2BRW1C Imprinted in placenta and liver protein IPLp17-BWR1C pleckstrin homology-like domain family A member 2 pleckstrin homology-like domain family A member 2 TSSC3p17-Beckwith-Wiedemann region 1C tumor suppressing subchromosomal transferable fragment cDNA 3 tumor suppressing subtransferable candidate 3 Tumor-suppressing STF cDNA 3 protein Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein tumor-supressing STF cDNA 3; Imprinted in placenta and liver protein; p17-Beckwith-Wiedemann region 1 C; p17-Beckwith-Wiedemann region 1C; p17-BWR1C; Pleckstrin homology-like domain family A member 2; pleckstrin homology-like domain, family A, member 2; tumor suppressing subchromosomal transferable fragment cDNA 3; tumor suppressing subtransferable candidate 3; Tumor-suppressing STF cDNA 3 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein; tumor-supressing STF cDNA 3
Gene Aliases: BRW1C; BWR1C; HLDA2; IPL; PHLDA2; TSSC3
UniProt ID: (Human) Q53GA4
Entrez Gene ID: (Human) 7262
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.