Novus Biologicals
Manufacturer Code:NBP15534920UL
Catalog # NBP15534920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TSR1(TSR1 20S rRNA accumulation homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TSR1. Peptide sequence MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10534 KIAA1401 MGC131829 pre-rRNA-processing protein TSR1 homolog TSR1 20S rRNA accumulation homolog (S. cerevisiae) TSR1 20S rRNA accumulation homolog (yeast); Pre-rRNA-processing protein TSR1 homolog
Gene Aliases: KIAA1401; TSR1
UniProt ID: (Human) Q2NL82
Entrez Gene ID: (Human) 55720
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.