Novus Biologicals
Manufacturer Code:NBP255729
Catalog # NBP255729
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 5.4.99 EC 5.4.99.- PUS4probable tRNA pseudouridine synthase 1 TruB pseudouridine (psi) synthase homolog 1 (E. coli); Probable tRNA pseudouridine synthase 1; TruB pseudouridine (psi) synthase family member 1; TruB pseudouridine (psi) synthase homolog 1
Gene Aliases: PUS4; TRUB1
UniProt ID: (Human) Q8WWH5
Entrez Gene ID: (Human) 142940
Molecular Function:
isomerase
lyase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.