Novus Biologicals
Manufacturer Code:NBP17413820UL
Catalog # NBP17413820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABP/ZF calcium channel CaT1 Calcium transport protein 1 CaT1 CaT-L CATL CaT-like ECaC2 ECAC2caT-L epithelial apical membrane calcium transporter/channel CaT1 Epithelial calcium channel 2Alu-binding protein with zinc finger domain HSA277909 LP6728 transient receptor potential cation channel subfamily V member 6 transient receptor potential cation channel subfamily V member 6 TrpV6 ZFAB; Alu-binding protein with zinc finger domain; Calcium transport protein 1; calcium transporter-like protein; CaT-L; CaT-like; CaT1; ECaC2; epithelial apical membrane calcium transporter/channel CaT1; Epithelial calcium channel 2; Transient receptor potential cation channel subfamily V member 6; TrpV6
Gene Aliases: ABP/ZF; CAT1; CATL; ECAC2; HSA277909; LP6728; TRPV6; ZFAB
UniProt ID: (Human) Q9H1D0
Entrez Gene ID: (Human) 55503
Molecular Function: ion channel transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.