Novus Biologicals
Manufacturer Code:NBP180210
Catalog # NBP180210
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human TRPM3. Peptide sequence YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.3.1.31 EC 5.99.1.3 Long transient receptor potential channel 3 LTrpC3 LTrpC-3 LTRPC3KIAA1616MLSN2GON-2 melastatin 2 melastatin-2 transient receptor potential cation channel subfamily M member 3 transient receptor potential cation channel subfamily M member 3; Long transient receptor potential channel 3; LTrpC-3; Melastatin-2; MLSN2; Transient receptor potential cation channel subfamily M member 3
Gene Aliases: GON-2; KIAA1616; LTRPC3; MLSN2; TRPM3
UniProt ID: (Human) Q9HCF6
Entrez Gene ID: (Human) 80036
Molecular Function:
ion channel
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.