Novus Biologicals
Manufacturer Code:NBP159618
Catalog # NBP159618
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TRPM2(transient receptor potential cation channel subfamily M member 2) The peptide sequence was selected from the N terminal of TRPM2. Peptide sequence VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.6.1.13 EREG1MGC133383 Estrogen-responsive element-associated gene 1 protein KNP3LTrpC-2 Long transient receptor potential channel 2 LTrpC2 LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2 NUDT9H NUDT9L1 transient receptor potential cation channel subfamily M member 2 Transient receptor potential channel 7 TrpC7; Estrogen-responsive element-associated gene 1 protein; Long transient receptor potential channel 2; LTrpC-2; Transient receptor potential cation channel subfamily M member 2; transient receptor potential cation channel, subfamily M, member 2; Transient receptor potential channel 7; Transient receptor potential melastatin 2; TrpC7
Gene Aliases: EREG1; KNP3; LTrpC-2; LTRPC2; NUDT9H; NUDT9L1; TRPC7; TRPM2
UniProt ID: (Human) O94759
Entrez Gene ID: (Human) 7226
Molecular Function:
ion channel
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.