Novus Biologicals
Manufacturer Code:NBP157301
Catalog # NBP157301
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TROVE2 (TROVE domain family member 2) The peptide sequence was selected from the N terminal of TROVE2. Peptide sequence QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 60 kDa ribonucleoprotein Ro; 60 kDa ribonucleoprotein Ro 60 kDa Ro protein 60 kDa SS-A/Ro ribonucleoprotein Ro 60 kDa autoantigen RO60gastric cancer multi-drug resistance protein RORNP Sjoegren syndrome antigen A2 Sjoegren syndrome type A antigen Sjogren syndrome antigen A2 (60kDa ribonucleoprotein autoantigen SS-A/Ro) SS-A SSA2Sjogren syndrome antigen A2 (60kD ribonucleoprotein autoantigen SS-A/Ro) TROVE domain family member 2 TROVE domain family member 2; 60 kDa Ro protein; 60 kDa SS-A/Ro ribonucleoprotein; gastric cancer multi-drug resistance protein; Ro 60 kDa autoantigen; Ro60 autoantigen; Sjoegren syndrome antigen A2; Sjoegren syndrome type A antigen; Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro); SS-A; TROVE domain family member 2; TROVE domain family, member 2
Gene Aliases: RO60; RORNP; SSA2; TROVE2
UniProt ID: (Human) P10155
Entrez Gene ID: (Human) 6738
Molecular Function:
RNA binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.