Novus Biologicals
Manufacturer Code:NBP157224
Catalog # NBP157224
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TRNT1 (tRNA nucleotidyl transferase CCA-adding 1) The peptide sequence was selected from the N terminal of TRNT1. Peptide sequence PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP(CTP):tRNA nucleotidyltransferase; CCA tRNA nucleotidyltransferase 1, mitochondrial; CCA-adding enzyme; CCA1 CCA-adding CGI-47 EC 2.7.7.72 mitochondrial CCA-adding tRNA-nucleotidyltransferase mt CCA-adding enzyme mt tRNA adenylyltransferase mt tRNA CCA-diphosphorylase mt tRNA CCA-pyrophosphorylase MtCCA tRNA nucleotidyl transferase CCA-adding 1 tRNA-nucleotidyltransferase 1 mitochondrial; mitochondrial CCA-adding tRNA-nucleotidyltransferase; Mitochondrial tRNA nucleotidyl transferase, CCA-adding; mt CCA-adding enzyme; mt tRNA adenylyltransferase; mt tRNA CCA-diphosphorylase; mt tRNA CCA-pyrophosphorylase; tRNA CCA nucleotidyl transferase 1; tRNA nucleotidyl transferase, CCA-adding, 1; tRNA-nucleotidyltransferase 1, mitochondrial
Gene Aliases: CCA1; CGI-47; MtCCA; RPEM; SIFD; TRNT1
UniProt ID: (Human) Q96Q11
Entrez Gene ID: (Human) 51095
Molecular Function: RNA binding protein mRNA polyadenylation factor mRNA processing factor nucleic acid binding nucleotidyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.