Novus Biologicals
Manufacturer Code:NBP187923
Catalog # NBP187923
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.8.1 EC 2.8.1.- FLJ10140 mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase mitochondrial tRNA-specific 2-thiouridylase 1 MTO2 homolog MTO2MGC99627 MTU1 TRMT TRMT1 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase TRNT1; lung cancer associated lncRNA 3; mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase; Mitochondrial tRNA-specific 2-thiouridylase 1; MTO2 homolog
Gene Aliases: LCAL3; MTO2; MTU1; TRMT; TRMT1; TRMU; TRNT1
UniProt ID: (Human) O75648
Entrez Gene ID: (Human) 55687
Molecular Function:
RNA binding protein
RNA methyltransferase
methyltransferase
nucleic acid binding
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.