Novus Biologicals
Manufacturer Code:NBP15287620UL
Catalog # NBP15287620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TRMT5(TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TRMT5. Peptide sequence EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: KIAA1393EC 2.1.1.31 M1G-methyltransferase TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae) TRM5MGC111453 tRNA (guanine-N(1)-)-methyltransferase tRNA [GM37] methyltransferase tRNA methyltransferase 5 tRNA-N1G37 methyltransferase; M1G-methyltransferase; TRM5 tRNA methyltransferase 5 homolog; TRMT5; tRNA (guanine(37)-N1)-methyltransferase; tRNA (guanine-N(1)-)-methyltransferase; tRNA [GM37] methyltransferase; tRNA methyltransferase 5 homolog; tRNA-N1G37 methyltransferase
Gene Aliases: COXPD26; KIAA1393; TRM5; TRMT5
UniProt ID: (Human) Q32P41
Entrez Gene ID: (Human) 57570
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.