Novus Biologicals
Manufacturer Code:NBP155029
Catalog # NBP155029
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TRIM72(tripartite motif-containing 72) The peptide sequence was selected from the N terminal of TRIM72 (NP_001008275). Peptide sequence CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Mg53; MG53Mg53 Mitsugumin-53 tripartite motif containing 72 tripartite motif-containing 72 tripartite motif-containing protein 72; mitsugumin 53; Mitsugumin-53; TRIM72; tripartite motif containing 72, E3 ubiquitin protein ligase; tripartite motif-containing 72; Tripartite motif-containing protein 72
Gene Aliases: MG53; TRIM72
UniProt ID: (Human) Q6ZMU5
Entrez Gene ID: (Human) 493829
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.