Novus Biologicals
Manufacturer Code:NBP213475
Catalog # NBP213475
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQ RDGIRVGHAVLAINGMDVNGRY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Hematopoietic stem/progenitor cell protein 172; Hematopoietic stem/progenitor cell protein 172 PTD009 SBDNHSPC172 Synbindin trafficking protein particle complex 4 trafficking protein particle complex subunit 4 TRS23 TRS23 homolog; Synbindin; Trafficking protein particle complex subunit 4; TRS23 homolog
Gene Aliases: CGI-104; HSPC172; PTD009; SBDN; SYNBINDIN; TRAPPC4; TRS23
UniProt ID: (Human) Q9Y296
Entrez Gene ID: (Human) 51399
Molecular Function: membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.