Novus Biologicals
Manufacturer Code:NBP247597
Catalog # NBP247597
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Heat shock protein 75 kDa, mitochondrial; HSP 75; HSP 75 HSP75TNFR-associated protein 1 HSP90Lheat shock protein 75 kDa mitochondrial TNF receptor-associated protein 1 TRAP-1 tumor necrosis factor type 1 receptor associated protein Tumor necrosis factor type 1 receptor-associated protein; testicular tissue protein Li 209; TNF receptor-associated protein 1; TNFR-associated protein 1; TRAP-1; Tumor necrosis factor type 1 receptor-associated protein
Gene Aliases: HSP 75; HSP75; HSP90L; TRAP-1; TRAP1
UniProt ID: (Human) Q12931
Entrez Gene ID: (Human) 10131
Molecular Function:
Hsp90 family chaperone
chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.