Novus Biologicals
Manufacturer Code:NBP156860
Catalog # NBP156860
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TPRKB(TP53RK binding protein) The peptide sequence was selected from the middle region of TPRKB. Peptide sequence EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CGI-121 PRPK (p53-related protein kinase)-binding protein PRPK-binding protein TP53RK binding protein TP53RK-binding protein; EKC/KEOPS complex subunit TPRKB; PRPK (p53-related protein kinase)-binding protein; PRPK-binding protein; TP53RK-binding protein
Gene Aliases: CGI-121; CGI121; My019; TPRKB
UniProt ID: (Human) Q9Y3C4
Entrez Gene ID: (Human) 51002
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.