Novus Biologicals
Manufacturer Code:NBP234109
Catalog # NBP234109
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 15 kDa interferon-responsive protein; FLJ77012 IFRG15 interferon responsive gene 15 LULL1MGC120077 lumenal domain like LAP1 Lumenal domain-like LAP1 MGC120074 MGC120075 MGC120076 MGC126581 MGC138430 NET9 RP11-12M5.5 torsin A interacting protein 2 torsin-1A-interacting protein 2; IFRG15; interferon responsive gene 15; lumenal domain like LAP1; Lumenal domain-like LAP1; torsin A interacting protein 2; Torsin-1A-interacting protein 2; Torsin-1A-interacting protein 2, isoform IFRG15
Gene Aliases: IFRG15; LULL1; NET9; TOR1AIP2
UniProt ID: (Human) Q8NFQ8
Entrez Gene ID: (Human) 163590
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.