Novus Biologicals
Manufacturer Code:NBP180671
Catalog # NBP180671
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1C9-2; 1C9-2 hTom22 mitochondrial import receptor subunit TOM22 homolog mitochondrial import receptor Tom22 MST065 TOM22MSTP065 Translocase of outer membrane 22 kDa subunit homolog translocase of outer mitochondrial membrane 22 homolog (yeast); hTom22; Mitochondrial import receptor subunit TOM22 homolog; mitochondrial import receptor Tom22; Translocase of outer membrane 22 kDa subunit homolog; translocase of outer mitochondrial membrane 22 homolog
Gene Aliases: 1C9-2; MST065; MSTP065; TOM22; TOMM22
UniProt ID: (Human) Q9NS69
Entrez Gene ID: (Human) 56993
Molecular Function: receptor transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.