Novus Biologicals
Manufacturer Code:NBP255173
Catalog # NBP255173
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RWAEDVPPQRLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRANVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B94 EXOC3L3 exocyst complex component 3-like 3 Primary response gene B94 protein TNF alpha-induced protein 2 tumor necrosis factor alpha-induced protein 2 tumor necrosis factor alpha-induced protein 2; exocyst complex component 3-like 3; Primary response gene B94 protein; TNF alpha-induced protein 2; Tumor necrosis factor alpha-induced protein 2; tumor necrosis factor, alpha induced protein 2; tumor necrosis factor, alpha-induced protein 2
Gene Aliases: B94; EXOC3L3; TNFAIP2
UniProt ID: (Human) Q03169
Entrez Gene ID: (Human) 7127
Molecular Function: membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.