Novus Biologicals
Manufacturer Code:NBP188931
Catalog # NBP188931
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B12 B61 BACURD2 BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 BTB/POZ domain-containing protein TNFAIP1 EDP1 hBACURD2 MGC2317 Protein B12 tumor necrosis factor alpha-induced protein 1 (endothelial) Tumor necrosis factor alpha-induced protein 1 endothelial; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2; BTB/POZ domain-containing protein TNFAIP1; hBACURD2; Protein B12; tumor necrosis factor, alpha induced protein 1; tumor necrosis factor, alpha-induced protein 1 (endothelial); Tumor necrosis factor, alpha-induced protein 1, endothelial
Gene Aliases: B12; B61; BACURD2; BTBD34; EDP1; hBACURD2; TNFAIP1
UniProt ID: (Human) Q13829
Entrez Gene ID: (Human) 7126
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.