Novus Biologicals
Manufacturer Code:NBP170730
Catalog # NBP170730
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TMEM91(transmembrane protein 91) The peptide sequence was selected from the N terminal of TMEM91. Peptide sequence SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Dispanin subfamily C member 3; DSPC3; IFITMD6 interferon induced transmembrane protein domain containing 6 transmembrane protein 91; interferon induced transmembrane protein domain containing 6; Transmembrane protein 91
Gene Aliases: DSPC3; IFITMD6; TMEM91
UniProt ID: (Human) Q6ZNR0
Entrez Gene ID: (Human) 641649
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.