Novus Biologicals
Manufacturer Code:NBP15983220UL
Catalog # NBP15983220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human TMEM79 (NP_115699). Peptide sequence LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ16057 FLJ32254 MGC13102 transmembrane protein 79; Mattrin; Transmembrane protein 79
Gene Aliases: MATT; TMEM79
UniProt ID: (Human) Q9BSE2
Entrez Gene ID: (Human) 84283
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.