Novus Biologicals
Manufacturer Code:NBP19160320UL
Catalog # NBP19160320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human TMEM48. Peptide sequence SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10407 FLJ34120 NDC1 NET3 transmembrane protein 48; hNDC1; nuclear division cycle 1 homolog; Nucleoporin NDC1; Transmembrane protein 48
Gene Aliases: NDC1; NET3; TMEM48
UniProt ID: (Human) Q9BTX1
Entrez Gene ID: (Human) 55706
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.