Novus Biologicals
Manufacturer Code:NBP183283
Catalog # NBP183283
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQAR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GS188 HCA112Hepatocellular carcinoma-associated antigen 112 likley ortholog of mouse GS188 transmembrane protein 176A; Hepatocellular carcinoma-associated antigen 112; likley ortholog of mouse GS188; Transmembrane protein 176A
Gene Aliases: GS188; HCA112; MS4B1; TMEM176A
UniProt ID: (Human) Q96HP8
Entrez Gene ID: (Human) 55365
Molecular Function:
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.