Novus Biologicals
Manufacturer Code:NBP15941720UL
Catalog # NBP15941720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TMC2(transmembrane channel-like 2) The peptide sequence was selected from the middle region of TMC2. Peptide sequence YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C20orf145 dJ686C3.3 transmembrane channel-like 2 transmembrane channel-like protein 2 Transmembrane cochlear-expressed protein 2 transmembrane cochlear expressed 2; transmembrane channel-like 2; Transmembrane channel-like protein 2; transmembrane cochlear-expressed gene 2; Transmembrane cochlear-expressed protein 2
Gene Aliases: C20orf145; TMC2; UNQ907/PRO1928
UniProt ID: (Human) Q6ZS41
Entrez Gene ID: (Human) 117532
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.