Novus Biologicals
Manufacturer Code:NBP18054820UL
Catalog # NBP18054820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human TM7SF2. Peptide sequence LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-beta-hydroxysterol Delta (14)-reductase; ANG1 C-14 sterol reductase delta(14)-sterol reductase delta-14-SR DHCR14A NET47 putative sterol reductase SR-1 sterol C14-reductase transmembrane 7 superfamily member 2; Another new gene 1 protein; C-14 sterol reductase; C14SR; Delta(14)-sterol reductase TM7SF2; Delta-14-SR; Putative sterol reductase SR-1; Sterol C14-reductase; Transmembrane 7 superfamily member 2
Gene Aliases: ANG1; DHCR14A; NET47; TM7SF2
UniProt ID: (Human) O76062
Entrez Gene ID: (Human) 7108
Molecular Function:
oxidoreductase
receptor
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.