Novus Biologicals
Manufacturer Code:NBP15517320UL
Catalog # NBP15517320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TKTL2(transketolase-like 2) The peptide sequence was selected from the C terminal of TKTL2. Peptide sequence SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZP434L1717 EC 2.2.1.1 FLJ32975 transketolase-like 2 transketolase-like protein 2; testis tissue sperm-binding protein Li 39a; transketolase-like 2; Transketolase-like protein 2
Gene Aliases: TKTL2
UniProt ID: (Human) Q9H0I9
Entrez Gene ID: (Human) 84076
Molecular Function: dehydrogenase lyase oxidoreductase transferase transketolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.