Novus Biologicals
Manufacturer Code:NBP247605
Catalog # NBP247605
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQML |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adapter protein wyatt; adapter protein wyatt Adaptor protein Wyatt MAL MyD88 adapter-like protein MyD88-2 TIR domain-containing adapter protein toll/interleukin-1 receptor domain-containing adapter protein toll-interleukin 1 receptor (TIR) domain containing adaptor protein Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein Toll-like receptor adaptor protein wyatt; Adaptor protein Wyatt; MyD88 adapter-like protein; MyD88-2; TIR domain-containing adapter protein; toll-interleukin 1 receptor (TIR) domain containing adaptor protein; Toll-like receptor adaptor protein; Toll/interleukin-1 receptor domain-containing adapter protein
Gene Aliases: BACTS1; MAL; MyD88-2; TIRAP; wyatt
UniProt ID: (Human) P58753
Entrez Gene ID: (Human) 114609
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.