Novus Biologicals
Manufacturer Code:NBP188170
Catalog # NBP188170
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 30 kDa HIV-1 TAT-interacting protein; 30 kDa HIV-1 TAT-interacting protein CC3oxidoreductase HTATIP2 EC 1.1.1 EC 1.1.1.- FLJ26963 HIV-1 Tat interactive protein 2 30 kDa HIV-1 Tat interactive protein 2 30kDa HIV-1 TAT-interactive protein 2 SDR44U1 Tat-interacting protein (30kD) TIP30short chain dehydrogenase/reductase family 44U member 1; HIV-1 Tat interactive protein 2, 30kDa; HIV-1 TAT-interactive protein 2; HTATIP2; Oxidoreductase HTATIP2; short chain dehydrogenase/reductase family 44U, member 1; Tat-interacting protein (30kD)
Gene Aliases: CC3; HTATIP2; SDR44U1; TIP30
UniProt ID: (Human) Q9BUP3
Entrez Gene ID: (Human) 10553
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.