Novus Biologicals
Manufacturer Code:NBP170723
Catalog # NBP170723
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to THNSL2(threonine synthase-like 2 (S. cerevisiae)) The peptide sequence was selected from the middle region of THNSL2. Peptide sequence LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10916 FLJ35504 secreted osteoclastogenic factor of activated T cells SOFAT threonine synthase-like 2 (S. cerevisiae) THS2 TSH2; secreted osteoclastogenic factor of activated T cells; Secreted osteoclastogenic factor of activated T-cells; SOFAT; Threonine synthase-like 2; TSH2
Gene Aliases: SOFAT; THNSL2; THS2; TSH2
UniProt ID: (Human) Q86YJ6
Entrez Gene ID: (Human) 55258
Molecular Function: deaminase dehydratase epimerase/racemase hydrolase isomerase lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.