Novus Biologicals
Manufacturer Code:NBP257259
Catalog # NBP257259
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ARVD FLJ16571 TGF-beta3 TGF-beta-3 transforming growth factor beta-3 transforming growth factor beta 3; LAP; Latency-associated peptide; prepro-transforming growth factor beta-3; TGF-beta-3; Transforming growth factor beta-3; Transforming growth factor beta-3 proprotein; transforming growth factor, beta 3
Gene Aliases: ARVD; ARVD1; LDS5; RNHF; TGF-beta3; TGFB3
UniProt ID: (Human) P10600
Entrez Gene ID: (Human) 7043
Molecular Function: growth factor signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.