Novus Biologicals
Manufacturer Code:NBP159437
Catalog # NBP159437
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TGFB2 (transforming growth factor beta 2) The peptide sequence was selected from the middle region of TGFB2)(50ug). Peptide sequence NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BSC-1 cell growth inhibitor; BSC-1 cell growth inhibitor Cetermin Glioblastoma-derived T-cell suppressor factor G-TSF MGC116892 Polyergin TGF-beta2 TGF-beta-2 transforming growth factor beta-2 transforming growth factor beta 2; Cetermin; G-TSF; Glioblastoma-derived T-cell suppressor factor; LAP; Latency-associated peptide; polyergin; prepro-transforming growth factor beta-2; TGF-beta-2; Transforming growth factor beta-2; Transforming growth factor beta-2 proprotein; transforming growth factor, beta 2
Gene Aliases: LDS4; TGF-beta2; TGFB2
UniProt ID: (Human) P61812
Entrez Gene ID: (Human) 7042
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.