Novus Biologicals
Manufacturer Code:NBP184357
Catalog # NBP184357
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cancer/testis antigen 131; cancer/testis antigen 131 Cell surface receptor NYD-SP8 CT131 MGC4766 NYD-SP8 PRO1884 Scleroderma-associated autoantigen SGRGGTPR867 Spermatogenesis-related gene protein TES101RP testis expressed 101 testis expressed sequence 101 testis-expressed protein 101 testis-specific protein TES101RP; Cell surface receptor NYD-SP8; Scleroderma-associated autoantigen; spermatogenesis associated 44; Spermatogenesis-related gene protein; testis expressed sequence 101; Testis-expressed protein 101; testis-specific protein TES101RP
Gene Aliases: CT131; GTPR867; NYD-SP8; PRO1884; SGRG; SPATA44; TES101RP; TEX101; UNQ867/PRO1884
UniProt ID: (Human) Q9BY14
Entrez Gene ID: (Human) 83639
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.