Novus Biologicals
Manufacturer Code:NBP158218
Catalog # NBP158218
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CCT7(chaperonin containing TCP1 subunit 7 (eta)) The peptide sequence was selected from the middle region of CCT7. Peptide sequence RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CCT-eta; CCT-eta CCTETA CCTH chaperonin containing TCP1 subunit 7 (eta) eta subunit HIV-1 Nef interacting protein HIV-1 Nef-interacting protein MGC110985 Nip7-1 T-complex protein 1 subunit eta; chaperonin containing t-complex polypeptide 1, eta subunit; HIV-1 Nef interacting protein; HIV-1 Nef-interacting protein; T-complex protein 1 subunit eta; T-complex protein 1 subunit eta, N-terminally processed; TCP-1-eta
Gene Aliases: CCT7; CCTETA; CCTH; NIP7-1; TCP1ETA
UniProt ID: (Human) Q99832
Entrez Gene ID: (Human) 10574
Molecular Function: chaperone chaperonin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.