Novus Biologicals
Manufacturer Code:NBP188148
Catalog # NBP188148
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CCT-alpha; CCT1T-complex protein 1 subunit alpha CCTa CCT-alpha D6S230E tailless complex polypeptide 1 t-complex 1 T-complex protein 1 alpha subunit TCP-1-alpha; T-complex protein 1 subunit alpha; T-complex protein 1, alpha subunit; tailless complex polypeptide 1; TCP-1-alpha
Gene Aliases: CCT-alpha; CCT1; CCTA; D6S230E; TCP-1-alpha; TCP1
UniProt ID: (Human) P17987
Entrez Gene ID: (Human) 6950
Molecular Function: chaperone chaperonin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.