Novus Biologicals
Manufacturer Code:NBP189333
Catalog # NBP189333
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: a3 Atp6i ATP6N1Cspecific 116-kDa vacuolar proton pump subunit ATP6V0A3T-cell immune response cDNA 7 OC-116 OC-116 kDa OC-116kDa OC116Vph1 OPTB1 Osteoclastic proton pump 116 kDa subunit Stv1 T-cell immune regulator 1 T-cell immune response cDNA7 protein T-cell immune regulator 1 T-cell immune regulator 1 ATPase H+ transporting lysosomal V0 protein a T-cell immune regulator 1 ATPase H+ transporting lysosomal V0 protein A3 T-cell immune regulator 1 ATPase H+ transporting lysosomal V0 protein aisoform 3 T-cell immune regulator 1 ATPase H+ transporting lysosomal V0 subunit A3 TIRC7ATPase H+ transporting 116kD vacuolar proton translocating ATPase 116 kDa subunit A Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3 V-ATPase 116 kDa isoform a3 V-ATPase 116-kDa V-type proton ATPase 116 kDa subunit a V-type proton ATPase 116 kDa subunit a isoform 3; ATPase, H+ transporting, 116kD; OC-116 kDa; Osteoclastic proton pump 116 kDa subunit; specific 116-kDa vacuolar proton pump subunit; T-cell immune regulator 1; T-cell immune response cDNA 7; T-cell immune response cDNA7 protein; T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a; T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3; TIRC7; V-ATPase 116 kDa subunit a3; V-ATPase 116-kDa; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a3; vacuolar proton translocating ATPase 116 kDa subunit A; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3
Gene Aliases: a3; Atp6i; ATP6N1C; ATP6V0A3; OC-116kDa; OC116; OPTB1; Stv1; TCIRG1; TIRC7; Vph1
UniProt ID: (Human) Q13488
Entrez Gene ID: (Human) 10312
Molecular Function:
ATP synthase
cation transporter
hydrolase
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.