Novus Biologicals
Manufacturer Code:NBP238611
Catalog # NBP238611
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bHLHb21; BHLHB21 bHLHb21TCF-3 Class B basic helix-loop-helix protein 21 E2A immunoglobulin enhancer-binding factor E12/E47 E2AKappa-E2-binding factor Immunoglobulin enhancer-binding factor E12/E47 Immunoglobulin transcription factor 1 ITF1Transcription factor ITF-1 MGC129647 MGC129648 Transcription factor 3 transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) transcription factor E2-alpha VDIR VDR interacting repressor; Class B basic helix-loop-helix protein 21; helix-loop-helix protein HE47; Immunoglobulin enhancer-binding factor E12/E47; Immunoglobulin transcription factor 1; Kappa-E2-binding factor; negative vitamin D response element-binding protein; NOL1-TCF3 fusion; TCF-3; Transcription factor 3; transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47); transcription factor 3 variant 3; Transcription factor E2-alpha; Transcription factor ITF-1; VDR interacting repressor; vitamin D receptor-interacting repressor
Gene Aliases: AGM8; BHLHB21; E2A; E47; ITF1; TCF-3; TCF3; VDIR
UniProt ID: (Human) P15923
Entrez Gene ID: (Human) 6929
Molecular Function: basic helix-loop-helix transcription factor nucleic acid binding transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.