Novus Biologicals
Manufacturer Code:NBP15666420UL
Catalog # NBP15666420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TCAP(titin-cap (telethonin)) The peptide sequence was selected from the N terminal of TCAP. Peptide sequence CSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRGLQEYQLPYQR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 19 kDa sarcomeric protein; 19 kDa sarcomeric protein CMD1NTitin cap protein LGMD2G limb girdle muscular dystrophy 2G (autosomal recessive) T-cap TELE telethonin titin-cap (telethonin); limb girdle muscular dystrophy 2G (autosomal recessive); Telethonin; teneurin C-terminal associated peptide; Titin cap protein
Gene Aliases: CMD1N; CMH25; LGMD2G; T-cap; TCAP; TELE; telethonin
UniProt ID: (Human) O15273
Entrez Gene ID: (Human) 8557
Molecular Function:
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.