Novus Biologicals
Manufacturer Code:NBP179855
Catalog # NBP179855
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human TBRG1The immunogen for this antibody is TBRG1. Peptide sequence KARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ14621 FLJ90113 MGC129890 NIAMFLJ25020 Nuclear interactor of ARF and Mdm2 TB-5 transforming growth factor beta regulator 1; Nuclear interactor of ARF and Mdm2; Transforming growth factor beta regulator 1
Gene Aliases: NIAM; TB-5; TBRG1
UniProt ID: (Human) Q3YBR2
Entrez Gene ID: (Human) 84897
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.